PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof000246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 264aa    MW: 28317 Da    PI: 4.7127
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-24038PU_refplantGDBView CDS
PUT-157a-Saccharum_officinarum-24035PU_unrefplantGDBView CDS
PUT-157a-Saccharum_officinarum-884133732PU_unrefplantGDBView CDS
PUT-157a-Saccharum_officinarum-24036PU_unrefplantGDBView CDS
PUT-157a-Saccharum_officinarum-884133733PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-183588356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k++++++eq+++Le+ Fe ++++  e++++LA+ l L+ rqV vWFqNrRa++k
  Sof000246 35 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLALQPRQVAVWFQNRRARWK 88
               45689************************************************9 PP

2HD-ZIP_I/II131.72.8e-4234126193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls+eqv++LE+sFe e+kLeperK++lar+L lqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+ke
    Sof000246  34 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLALQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRHDHDALRRDKDALLAEIKE 126
                  69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-192392IPR009057Homeodomain-like
PROSITE profilePS5007117.1193090IPR001356Homeobox domain
SMARTSM003891.3E-163394IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-193494IPR009057Homeodomain-like
CDDcd000862.48E-173591No hitNo description
PfamPF000461.4E-153588IPR001356Homeobox domain
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PfamPF021831.3E-1790131IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MTNPDDDGYG VVGMEAEADA DEEMMACGGG GGGEKKRRLS AEQVRALERS FEVENKLEPE  60
RKARLARDLA LQPRQVAVWF QNRRARWKTK QLERDYAALR HSYDALRHDH DALRRDKDAL  120
LAEIKELKAK LGDEEAAASY TSVKAEPAAS DGPPPVGVGS SESDSSAVLN DADPPVPEAP  180
VPEVQGGTLL DAPCAVAGPA AAENNGGVFF HGSFLEGGGR QNGASGRRPA GGGSYRDTAA  240
MRVDHHDTDD EQRDQHESIC TGDK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15965ERKARLA
28290RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.28531e-180bud| inflorescence| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957072.11e-121PREDICTED: homeobox-leucine zipper protein HOX4-like
SwissprotQ6K4985e-96HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH375e-96HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLK3ZW401e-121K3ZW40_SETIT; Uncharacterized protein
STRINGSi030822m1e-120(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-40homeobox protein 6